NAIBio Development

   Protein Analysis & Antibody Platform

Advanced Protein & Antibody Development Suite

Harness the power of AlphaFold3, SABpred, and AbodyBuilder2 in a unified platform for protein structure prediction and antibody engineering.

Integrated Technologies

Combining cutting-edge computational tools in one platform

AlphaFold3

State-of-the-art diffusion-based protein structure prediction with unprecedented accuracy for both single proteins and complexes.

Access AlphaFold3

SABpred

Comprehensive suite for structural antibody prediction, modeling CDR loops with superior accuracy and antibody engineering capabilities.

Access SABpred

AbodyBuilder2

Advanced framework for antibody structure modeling, optimizing VH/VL orientation and predicting CDR loop configurations.

Try AbodyBuilder2

Platform Tools

Everything you need for protein analysis and antibody development

Protein Structure Prediction

Access AlphaFold's revolutionary diffusion-based approach for highly accurate protein structure prediction. Choose between online server or local installation.

Online Prediction Server

Quick access to AlphaFold through web interface

Access Server

Local Installation

Run AlphaFold3 locally with full control

View Source

Latest Developments

Learn about new features and improvements

Read Blog

Quick Start Guide

  1. Visit the AlphaFold Server
  2. Input your protein sequence in FASTA format
  3. Select prediction options
  4. Submit and wait for results
  5. Download and analyze the structure

Sample FASTA Input

>P53_HUMAN
MEEPQSDPSVEPPLSQETFSDL
WKLLPENNVLSPLPSQAMDDLM
LSPDDIEQWFTEDPGP

Streamlined Workflow

From sequence to structure to function

Input Preparation

Upload protein sequences, structures, or multiple sequence alignments. NAIBio Dev supports multiple input formats including FASTA, PDB, mmCIF, A3M, and more.

>P53_HUMAN MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP DEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE

Structure Prediction

Choose from AlphaFold3, ESMFold, or other prediction methods based on your needs. Set parameters for accuracy, speed, and output formats.

AlphaFold3

State-of-the-art prediction

ESMFold

Fast and accurate

Structural Analysis

Analyze predicted structures using a comprehensive suite of tools for quality assessment, structural comparisons, cavity detection, and more.

Quality Analysis

Structure validation

Comparison Tools

Structure alignment

Resources & Documentation

Everything you need to get started

Documentation

Comprehensive guides, API references, and examples to help you get the most out of NAIBio Dev.

  • Getting Started Guide
  • API Documentation
  • Code Examples
Learn More About AlphaFold

SABpred Tools

Access advanced antibody structure prediction and analysis tools.

  • Antibody Structure Prediction
  • CDR Loop Modeling
  • Antibody Analysis
Access SABpred Tools

AbodyBuilder2

Advanced antibody modeling and engineering platform.

  • Antibody Structure Modeling
  • Framework Analysis
  • Design Optimization
Try AbodyBuilder2

Get in Touch

Have questions? We're here to help.

Send us a Message

Contact Information

Address

222 Innovation Drive
Cambridge, MA 02142
United States

Email

contact@naibio.dev
support@naibio.dev

Phone

+1 (555) 103-4655

Hours

Monday - Friday
9:00 AM - 6:00 PM EST

Follow Us